TA341887 SEC63 antibody

Rabbit Polyclonal Anti-SEC63 Antibody

See related secondary antibodies

Search for all "SEC63"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SEC63

Product Description for SEC63

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SEC63.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SEC63

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SEC63L, Translocation protein SEC63 homolog
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UGP8
Immunogen:
The immunogen for anti-SEC63 antibody: synthetic peptide directed towards the N terminal of human SEC63. Synthetic peptide located within the following region: WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA.
GeneID:
11231
Application WB
Background The Sec61 complex isThe central component ofThe protein translocation apparatus ofThe endoplasmic reticulum (ER) membrane.The protein encoded byThis gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translatiol protein translocation intoThe ER.The Sec61-Sec62-Sec63 complex might also performThe backward transport of ER proteins that are subject toThe ubiquitin-proteasome-dependent degradation pathway.The encoded protein is an integral membrane protein located inThe rough ER. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SEC63 (1 products)

Catalog No. Species Pres. Purity   Source  

SEC63

SEC63 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for SEC63 (1 products)

Catalog No. Species Pres. Purity   Source  

SEC63 overexpression lysate

SEC63 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn