TA341874 Reticulon-4 / RTN4 antibody

Rabbit Polyclonal Anti-RTN4 Antibody

See related secondary antibodies

Search for all "Reticulon-4 / RTN4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Reticulon-4 / RTN4

Product Description for Reticulon-4 / RTN4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Reticulon-4 / RTN4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Reticulon-4 / RTN4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Foocen, KIAA0886, NOGO, NSP, Neurite outgrowth inhibitor, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, Reticulon-5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQC3
Immunogen:
The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI.
GeneID:
57142
Application WB
Background This gene belongs toThe family of reticulon encoding genes. Reticulons are associated withThe endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.The product ofThis gene is a potent neurite outgrowth inhibitor which may also help blockThe regeneration ofThe central nervous system in higher vertebrates. Altertively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Reticulon-4 / RTN4 (2 products)

Catalog No. Species Pres. Purity   Source  

Reticulon-4 / RTN4 (transcript variant 4)

Reticulon-4 / RTN4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Reticulon-4 / RTN4 (transcript variant 3)

Reticulon-4 / RTN4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for Reticulon-4 / RTN4 (3 products)

Catalog No. Species Pres. Purity   Source  

RTN4 overexpression lysate

RTN4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

RTN4 overexpression lysate

RTN4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

RTN4 overexpression lysate

RTN4 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn