TA341871 Melanoma gp100 antibody

Rabbit Polyclonal Anti-SILV Antibody

See related secondary antibodies

Search for all "Melanoma gp100"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat Melanoma gp100

TA341871

More Views

  • TA341871

Product Description for Melanoma gp100

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat Melanoma gp100.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Melanoma gp100

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms D12S53E, ME20-M, Melanocyte lineage-specific antigen GP100, Melanocyte protein Pmel 17, Melanoma-associated ME20 antigen, PMEL17, SILV, Silver locus protein homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P40967
Immunogen:
The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY.
GeneID:
6490
Application WB
IHC
Background This gene encodes a melanocyte-specific type I transmembrane glycoprotein.The encoded protein is enriched in melanosomes, which areThe melanin-producing organelles in melanocytes, and plays an essential role inThe structural organization of premelanosomes.This protein is involved in generating interl matrix fibers that defineThe transition from Stage I to Stage II melanosomes.This protein undergoes a complex pattern of prosttranslatiol processing and modification that is essential toThe proper functioning ofThe protein. A secreted form ofThis protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alterte splicing results in multiple transcript variants. [provided by RefSeq, Jan 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Melanoma gp100 (4 products)

Catalog No. Species Pres. Purity   Source  

Melanoma gp100

Melanoma gp100 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Melanoma gp100

Melanoma gp100 Human Purified E. coli
  OriGene Technologies GmbH

Melanoma gp100

Melanoma gp100 Human Purified E. coli
  OriGene Technologies GmbH

Melanoma gp100

Melanoma gp100 Human Purified E. coli
  OriGene Technologies GmbH

Positive controls for Melanoma gp100 (1 products)

Catalog No. Species Pres. Purity   Source  

PMEL overexpression lysate

PMEL overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn