TA341813 SIN3B antibody

Rabbit Polyclonal Anti-SIN3B Antibody

See related secondary antibodies

Search for all "SIN3B"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat SIN3B

Product Description for SIN3B

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat SIN3B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIN3B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Histone deacetylase complex subunit Sin3b, KIAA0700, Paired amphipathic helix protein Sin3b, Transcriptional corepressor Sin3b
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75182
Immunogen:
The immunogen for anti-SIN3B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV.
GeneID:
23309
Application WB
Background Sin3B is one ofThe Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SIN3B (1 products)

Catalog No. Species Pres. Purity   Source  

SIN3B overexpression lysate

SIN3B overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn