TA341809 RELB / I-Rel antibody

Rabbit Polyclonal Anti-RELB Antibody

See related secondary antibodies

Search for all "RELB / I-Rel"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RELB / I-Rel

TA341809

Product Description for RELB / I-Rel

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RELB / I-Rel.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RELB / I-Rel

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rel B, Transcription factor RelB
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q01201
Immunogen:
The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of mouse RELB. Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG.
GeneID:
5971
Application WB
Background RelB is a member ofThe Rel/nuclear factor (NF)-kappa B family of transcription factors, defects in RelB affects antigen presenting cells andThe formation of lymphoid organs. Targeted disruption ofThe Rel/NF-kappaB family members NF-kappaB2, encoding p100/p52, and RelB in mice results in atomical defects of secondary lymphoid tissues.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RELB / I-Rel (1 products)

Catalog No. Species Pres. Purity   Source  

RELB / I-Rel

RELB / I-Rel Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for RELB / I-Rel (1 products)

Catalog No. Species Pres. Purity   Source  

RELB overexpression lysate

RELB overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn