TA341798 PKMYT1 antibody

Rabbit Polyclonal Anti-Myt1 Antibody

See related secondary antibodies

Search for all "PKMYT1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PKMYT1

Product Description for PKMYT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PKMYT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PKMYT1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MYT1, Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase, Myt1 kinase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99640
Immunogen:
The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS.
GeneID:
9088
Application WB
Background This gene is a member ofThe myelin transcription factor 1 gene family.The encoded protein, a zinc finger D-binding protein, is involved in regulation of oligodendrocyte differentiation and proliferation inThe developing central nervous system.The gene product has a role in remyelition through regeneration of oligodendrocyte lineage cells in response to demyelition. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PKMYT1 (1 products)

Catalog No. Species Pres. Purity   Source  

PKMYT1 (transcript variant 1)

PKMYT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn