TA341789 LYL1 antibody

Rabbit Polyclonal Anti-Lyl1 Antibody

See related secondary antibodies

Search for all "LYL1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Mouse, Rat LYL1

Product Description for LYL1

Rabbit anti Mouse, Rat LYL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LYL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHLHA18, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1, Protein lyl-1
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q66HH3
Immunogen:
The immunogen for Anti-Lyl1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lyl1. Synthetic peptide located within the following region: GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR.
GeneID:
304663
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn