TA341779 HOXB13 antibody

Rabbit Polyclonal Anti-Hoxb13 Antibody

See related secondary antibodies

Search for all "HOXB13"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat HOXB13

Product Description for HOXB13

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat HOXB13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-B13
Presentation Purified
Reactivity GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92826
Immunogen:
The immunogen for anti-Hoxb13 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb13. Synthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA.
GeneID:
10481
Application WB
Background Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities onThe anterior-posterior axis.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB13 (2 products)

Catalog No. Species Pres. Purity   Source  

HOXB13 (1-284, His-tag)

HOXB13 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

HOXB13 (1-284, His-tag)

HOXB13 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn