TA341767 GCM1 / GCMA antibody

Rabbit Polyclonal Anti-Gcm1 Antibody

See related secondary antibodies

Search for all "GCM1 / GCMA"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Mouse, Rat GCM1 / GCMA

Product Description for GCM1 / GCMA

Rabbit anti Mouse, Rat GCM1 / GCMA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GCM1 / GCMA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Chorion-specific transcription factor GCMa, GCM motif protein 1, Glial cells missing homolog 1
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P70348
Immunogen:
The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the middle region of mouse Gcm1. Synthetic peptide located within the following region: EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN.
GeneID:
14531
Application WB
Background Transcription factor that is necessary for placental development
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn