TA341707 MCM8 antibody

Rabbit Polyclonal Anti-MCM8 Antibody

See related secondary antibodies

Search for all "MCM8"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MCM8

Product Description for MCM8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MCM8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MCM8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf154, DNA replication licensing factor MCM8, minichromosome maintenance complex component 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJA3
Immunogen:
The immunogen for anti-MCM8 antibody: synthetic peptide directed towards the N terminal of human MCM8. Synthetic peptide located within the following region: RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGS.
GeneID:
84515
Application WB
Background The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintence proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed byThe mini-chromosome maintence proteins is a key component ofThe pre-replication complex and may be involved inThe formation of replication forks and inThe recruitment of other D replication related proteins.This protein containsThe central domain that is conserved amongThe mini-chromosome maintence proteins.The encoded protein may interact with other mini-chromosome maintence proteins and play a role in D replication.This gene may be associated with length of reproductive lifespan and menopause. Altertively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2013].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn