TA341650 Annexin A3 / ANXA3 antibody

Rabbit Polyclonal Anti-ANXA3 Antibody

See related secondary antibodies

Search for all "Annexin A3 / ANXA3"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Annexin A3 / ANXA3

Product Description for Annexin A3 / ANXA3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Annexin A3 / ANXA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin A3 / ANXA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 2-cyclic phosphate 2-phosphohydrolase, 35-alpha calcimedin, ANX3, Annexin III, Annexin-3, Inositol 1, Lipocortin III, PAP-III, Placental anticoagulant protein III
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P12429
Immunogen:
The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD.
GeneID:
306
Application WB
Background This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in sigl transduction pathways.This protein functions inThe inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Annexin A3 / ANXA3 (4 products)

Catalog No. Species Pres. Purity   Source  

Annexin A3 / ANXA3

Annexin A3 / ANXA3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Annexin A3 / ANXA3 (1-323)

Recombinant human Annexin A3 (1-323 aa): 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $720.00
  OriGene Technologies GmbH

Annexin A3 / ANXA3 (1-323)

Recombinant human Annexin A3 (1-323 aa): 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $290.00
  OriGene Technologies GmbH

Annexin A3 / ANXA3

Annexin A3 / ANXA3 Bovine Purified > 95 % Sequential chromatography of EGTA eluted Ca2+ -dependent membrane binding proteins by DEAE Sephacel, hydroxlapatite and Superose 12. Lung
  OriGene Technologies GmbH

Positive controls for Annexin A3 / ANXA3 (1 products)

Catalog No. Species Pres. Purity   Source  

ANXA3 overexpression lysate

ANXA3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn