TA341524 ZFP42 antibody

Rabbit Polyclonal Anti-ZFP42 Antibody

See related secondary antibodies

Search for all "ZFP42"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ZFP42

TA341524

More Views

  • TA341524
  • TA341524

Product Description for ZFP42

Rabbit anti Human ZFP42.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFP42

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms REX-1, REX1, Reduced expression protein 1, ZNF754, Zfp-42, Zinc finger protein 754
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MM3
Immunogen:
The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the N terminal of human ZFP42. Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC.
GeneID:
132625
Application WB
Background Involved inThe reprogramming of X-chromosome ictivation duringThe acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding R antisense to XIST. Binds DXPas34 enhancer withinThe TSIX promoter. Involved in ES cell self-renewal.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZFP42 (1 products)

Catalog No. Species Pres. Purity   Source  

ZFP42 overexpression lysate

ZFP42 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn