TA341466 LASS5 antibody

Rabbit Polyclonal Anti-LASS5 Antibody

See related secondary antibodies

Search for all "LASS5"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LASS5

Product Description for LASS5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LASS5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LASS5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LAG1 longevity assurance homolog 5, LASS5, TRAM homolog 4, TRH4, Translocating chain-associating membrane protein homolog 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5B7
Immunogen:
The immunogen for anti-LASS5 antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR.
GeneID:
91012
Application WB
Background This gene encodes a protein that belongs toThe TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins.The encoded protein functions inThe synthesis of ceramide, a lipid molecule that is involved in a several cellular sigling pathways. Alterte splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn