TA341451 TGIF2LX antibody

Rabbit Polyclonal Anti-TGIF2LX Antibody

See related secondary antibodies

Search for all "TGIF2LX"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Rat TGIF2LX

Product Description for TGIF2LX

Rabbit anti Human, Rat TGIF2LX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TGIF2LX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein TGIF2LX, TGF(beta)induced transcription factor 2-like protein, TGFB-induced factor 2-like protein X-linked, TGIF-like on the X, TGIFLX
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUE1
Immunogen:
The immunogen for anti-TGIF2LX antibody: synthetic peptide directed towards the middle region of human TGIF2LX. Synthetic peptide located within the following region: SGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKV.
GeneID:
90316
Application WB
Background This gene encodes a member ofThe TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests thatThis gene may play a role in spermatogenesis. A homolog ofThis gene lies withinThe male specific region of chromosome Y, in a block of sequence that is thought to beThe result of a large X-to-Y transposition. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TGIF2LX (2 products)

Catalog No. Species Pres. Purity   Source  

TGIF2LX (1-241, His-tag)

TGIF2LX Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

TGIF2LX (1-241, His-tag)

TGIF2LX Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for TGIF2LX (1 products)

Catalog No. Species Pres. Purity   Source  

TGIF2LX overexpression lysate

TGIF2LX overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn