TA341433 ZNF764 antibody

Rabbit Polyclonal Anti-ZNF764 Antibody

See related secondary antibodies

Search for all "ZNF764"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ZNF764

Product Description for ZNF764

Rabbit anti Human ZNF764.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF764

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 764
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 45 kDa (408 aa)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96H86
Immunogen:
A synthetic peptide located within the following region:
AA Sequence:
KKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGR
GeneID:
92595
Application Western blotting: 0.2 . 1.0 µg/ml.
Background ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004).
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

  • LinkedIn