TA340350 WDR66 antibody

Rabbit Polyclonal Anti-WDR66 Antibody

See related secondary antibodies

Search for all "WDR66"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Porcine WDR66

Product Description for WDR66

Rabbit anti Canine, Human, Porcine WDR66.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR66

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WD repeat-containing protein 66
Presentation Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBY9
Immunogen:
The immunogen for anti-WDR66 antibody: synthetic peptide directed towards the N terminal of human WDR66. Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV.
GeneID:
144406
Application WB
Background WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for WDR66 (1 products)

Catalog No. Species Pres. Purity   Source  

WDR66 overexpression lysate

WDR66 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn