TA340311 ANKRD54 / LIAR antibody

Rabbit Polyclonal Anti-ANKRD54 Antibody

See related secondary antibodies

Search for all "ANKRD54 / LIAR"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD54 / LIAR

Product Description for ANKRD54 / LIAR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD54 / LIAR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD54 / LIAR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat domain-containing protein 54
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NXT1
Immunogen:
The immunogen for anti-ANKRD54 antibody: synthetic peptide directed towards the middle region of human ANKRD54. Synthetic peptide located within the following region: EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND.
GeneID:
129138
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ANKRD54 / LIAR (3 products)

Catalog No. Species Pres. Purity   Source  

ANKRD54 / LIAR

ANKRD54 / LIAR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

ANKRD54 / LIAR (1-300, His-tag)

ANKRD54 / LIAR Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $820.00
  OriGene Technologies GmbH

ANKRD54 / LIAR (1-300, His-tag)

ANKRD54 / LIAR Human Purified > 85 % by SDS - PAGE E. coli
20 µg / $320.00
  OriGene Technologies GmbH

Positive controls for ANKRD54 / LIAR (1 products)

Catalog No. Species Pres. Purity   Source  

ANKRD54 overexpression lysate

ANKRD54 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn