TA340228 Arginine decarboxylase / ADC antibody

Rabbit Polyclonal Anti-ADC Antibody

See related secondary antibodies

Search for all "Arginine decarboxylase / ADC"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast Arginine decarboxylase / ADC

Product Description for Arginine decarboxylase / ADC

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast Arginine decarboxylase / ADC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Arginine decarboxylase / ADC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARGDC, KIAA1945, ODC-paralogue, ODCP, Ornithine decarboxylase-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A70
Immunogen:
The immunogen for Anti-ADC antibody is: synthetic peptide directed towards the C-terminal region of Human ADC. Synthetic peptide located within the following region: AELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGV.
GeneID:
113451
Application WB
Background ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn