TA340165 Calcium-binding protein p22 antibody

Rabbit Polyclonal Anti-CHP1 Antibody

See related secondary antibodies

Search for all "Calcium-binding protein p22"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Calcium-binding protein p22

TA340165

More Views

  • TA340165

Product Description for Calcium-binding protein p22

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Calcium-binding protein p22.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Calcium-binding protein p22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Calcineurin B homolog, Calcineurin homologous protein, Calcium-binding protein CHP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99653
Immunogen:
The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM.
GeneID:
11261
Application WB
IHC
Background This gene encodes a phosphoprotein that binds to the +/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Calcium-binding protein p22 (3 products)

Catalog No. Species Pres. Purity   Source  

Calcium-binding protein p22

Calcium-binding protein p22 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Calcium-binding protein p22 (1-195, His-tag)

Calcium-binding protein p22 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / $720.00
  OriGene Technologies GmbH

Calcium-binding protein p22 (1-195, His-tag)

Calcium-binding protein p22 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / $290.00
  OriGene Technologies GmbH
  • LinkedIn