TA340151 AP4S1 antibody

Rabbit Polyclonal Anti-Ap4s1 Antibody

See related secondary antibodies

Search for all "AP4S1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish AP4S1

Product Description for AP4S1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish AP4S1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AP4S1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AP-4 adaptor complex subunit sigma-1, AP-4 complex subunit sigma-1, Adaptor-related protein complex 4 subunit sigma-1, Sigma-1 subunit of AP-4, Sigma-4-adaptin, Sigma4-adaptin
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y587
Immunogen:
The immunogen for Anti-Ap4s1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ap4s1. Synthetic peptide located within the following region: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI.
GeneID:
366618
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for AP4S1 (1 products)

Catalog No. Species Pres. Purity   Source  

AP4S1 overexpression lysate

AP4S1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn