TA339599 KIRREL2 antibody

Rabbit Polyclonal Anti-KIRREL2 Antibody

See related secondary antibodies

Search for all "KIRREL2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KIRREL2

Product Description for KIRREL2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KIRREL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIRREL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Filtrin, KIRREL2, Kin of IRRE-like protein 2, Kin of irregular chiasm-like protein 2, NEPH3, NLG1, Nephrin-like protein 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWL6
Immunogen:
The immunogen for anti-KIRREL2 antibody: synthetic peptide directed towards the N terminal of human KIRREL2. Synthetic peptide located within the following region: WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLV.
GeneID:
84063
Application WB
Background KIRREL2 is a single-pass type I membrane protein. KIRREL2 protein is a beta-cell-expressed Ig domain protein and may be involved in pancreas development or beta cell function.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIRREL2 (1 products)

Catalog No. Species Pres. Purity   Source  

KIRREL2 (full length, N-term HIS tag, transcript variant 1)

KIRREL2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for KIRREL2 (1 products)

Catalog No. Species Pres. Purity   Source  

KIRREL2 overexpression lysate

KIRREL2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn