TA339594 SPATA9 antibody

Rabbit Polyclonal Anti-SPATA9 Antibody

See related secondary antibodies

Search for all "SPATA9"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine SPATA9

Product Description for SPATA9

Rabbit anti Bovine, Canine, Equine, Human, Porcine SPATA9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPATA9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NYD-SP16, Spermatogenesis-associated protein 9
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWV2
Immunogen:
The immunogen for anti-SPATA9 antibody: synthetic peptide directed towards the N terminal of human SPATA9. Synthetic peptide located within the following region: FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR.
GeneID:
83890
Application WB
Background SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SPATA9 (1 products)

Catalog No. Species Pres. Purity   Source  

SPATA9 overexpression lysate

SPATA9 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn