TA339591 Extended synaptotagmin-3 antibody

Rabbit Polyclonal Anti-ESYT3 Antibody

See related secondary antibodies

Search for all "Extended synaptotagmin-3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Extended synaptotagmin-3

Product Description for Extended synaptotagmin-3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Extended synaptotagmin-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Extended synaptotagmin-3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Chr3syt, ESYT3, FAM62C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A0FGR9
Immunogen:
The immunogen for anti-FAM62C antibody: synthetic peptide directed towards the middle region of human FAM62C. Synthetic peptide located within the following region: EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF.
GeneID:
83850
Application WB
Background ESYT3 belongs to the extended syptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. ESYT3 may play a role as calcium-regulated intrinsic membrane protein.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Extended synaptotagmin-3 (1 products)

Catalog No. Species Pres. Purity   Source  

ESYT3 overexpression lysate

ESYT3 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn