TA339578 GLT8D2 / GALA4A antibody

Rabbit Polyclonal Anti-GLT8D2 Antibody

See related secondary antibodies

Search for all "GLT8D2 / GALA4A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GLT8D2 / GALA4A

Product Description for GLT8D2 / GALA4A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GLT8D2 / GALA4A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GLT8D2 / GALA4A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glycosyltransferase 8 domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1C3
Immunogen:
The immunogen for anti-GLT8D2 antibody: synthetic peptide directed towards the C terminal of human GLT8D2. Synthetic peptide located within the following region: IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP.
GeneID:
83468
Application WB
Background GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GLT8D2 / GALA4A (1 products)

Catalog No. Species Pres. Purity   Source  

GLT8D2 / GALA4A

GLT8D2 / GALA4A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for GLT8D2 / GALA4A (1 products)

Catalog No. Species Pres. Purity   Source  

GLT8D2 overexpression lysate

GLT8D2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn