TA339544 ZNF649 antibody

Rabbit Polyclonal Anti-ZNF649 Antibody

See related secondary antibodies

Search for all "ZNF649"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human ZNF649

Product Description for ZNF649

Rabbit anti Equine, Human ZNF649.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF649

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 649
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BS31
Immunogen:
The immunogen for anti-ZNF649 antibody: synthetic peptide directed towards the N terminal of human ZNF649. Synthetic peptide located within the following region: HGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESR.
GeneID:
65251
Application WB
Background ZNF649 is the transcriptiol repressor. ZNF649 is the regulator of transcriptiol factor complexes and may suppress SRE and AP-1 transcription activities mediated by growth factor sigling pathways.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF649 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF649 overexpression lysate

ZNF649 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn