TA339534 ZNF350 antibody

Rabbit Polyclonal Anti-ZNF350 Antibody

See related secondary antibodies

Search for all "ZNF350"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ZNF350

TA339534

Product Description for ZNF350

Rabbit anti Human ZNF350.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF350

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KRAB zinc finger protein ZFQR, ZBRK1, ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein 350, Zinc finger protein ZBRK1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZX5
Immunogen:
The immunogen for anti-ZNF350 antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: QFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHAN.
GeneID:
59348
Application WB
Background ZNF350 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF350 is a transcriptiol repressor. It binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF350 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF350 overexpression lysate

ZNF350 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn