TA339514 LHX9 antibody

Rabbit Polyclonal Anti-LHX9 Antibody

See related secondary antibodies

Search for all "LHX9"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LHX9

Product Description for LHX9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LHX9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LHX9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LHX9, LIM homeobox protein 9, LIM/homeobox protein Lhx9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ69
Immunogen:
The immunogen for anti-LHX9 antibody: synthetic peptide directed towards the C terminal of human LHX9. Synthetic peptide located within the following region: SFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF.
GeneID:
56956
Application WB
Background This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes godal agenesis when ictivated, suggesting a role in godal development. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for LHX9 (1 products)

Catalog No. Species Pres. Purity   Source  

LHX9 overexpression lysate

LHX9 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn