TA339511 ZNF307 antibody

Rabbit Polyclonal Anti-ZNF307 Antibody

See related secondary antibodies

Search for all "ZNF307"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Rabbit ZNF307

Product Description for ZNF307

Rabbit anti Bovine, Equine, Human, Rabbit ZNF307.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF307

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms P373c6.1, ZKSCAN4, Zinc finger protein 307, Zinc finger protein with KRAB and SCAN domains 4
Presentation Purified
Reactivity Bov, Eq, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969J2
Immunogen:
The immunogen for anti-ZNF307 antibody: synthetic peptide directed towards the N terminal of human ZNF307. Synthetic peptide located within the following region: MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPE.
GeneID:
387032
Application WB
Background ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF307 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF307

ZNF307 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for ZNF307 (1 products)

Catalog No. Species Pres. Purity   Source  

ZKSCAN4 overexpression lysate

ZKSCAN4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn