TA339484 HSFX1 antibody

Rabbit Polyclonal Anti-HSFX1 Antibody

See related secondary antibodies

Search for all "HSFX1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human HSFX1

Product Description for HSFX1

Rabbit anti Human HSFX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HSFX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSFX1, HSFX2, Heat shock transcription factor, LW-1, X-linked
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBD0
Immunogen:
The immunogen for anti-HSFX1 antibody: synthetic peptide directed towards the middle region of human HSFX1. Synthetic peptide located within the following region: QVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSE.
GeneID:
100130086
Application WB
Background The exact function of HSFX1 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HSFX1 (1 products)

Catalog No. Species Pres. Purity   Source  

HSFX1 (full length, N-term HIS tag)

HSFX1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for HSFX1 (2 products)

Catalog No. Species Pres. Purity   Source  

HSFX1 overexpression lysate

HSFX1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

HSFX2 overexpression lysate

HSFX2 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn