TA339420 IL11RA antibody

Rabbit Polyclonal Anti-IL11RA Antibody

See related secondary antibodies

Search for all "IL11RA"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat IL11RA

Product Description for IL11RA

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat IL11RA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IL11RA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IL-11 receptor subunit alpha, IL-11R-alpha, IL-11RA, Interleukin-11 receptor alpha chain
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14626
Immunogen:
The immunogen for anti-IL11RA antibody: synthetic peptide directed towards the middle region of human IL11RA. Synthetic peptide located within the following region: FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA.
GeneID:
3590
Application WB
Background Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Multiple altertively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn