TA339405 PIGL antibody

Rabbit Polyclonal Anti-PIGL Antibody

See related secondary antibodies

Search for all "PIGL"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human PIGL

Product Description for PIGL

Rabbit anti Human PIGL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PIGL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIG-L, Phosphatidylinositol-glycan biosynthesis class L protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2B2
Immunogen:
The immunogen for anti-PIGL antibody: synthetic peptide directed towards the N terminal of human PIGL. Synthetic peptide located within the following region: MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP.
GeneID:
9487
Application WB
Background This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (Glcc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PIGL (1 products)

Catalog No. Species Pres. Purity   Source  

PIGL

PIGL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for PIGL (1 products)

Catalog No. Species Pres. Purity   Source  

PIGL overexpression lysate

PIGL overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn