TA339380 CDS2 antibody

Rabbit Polyclonal Anti-CDS2 Antibody

See related secondary antibodies

Search for all "CDS2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CDS2

Product Description for CDS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CDS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDP-DAG synthase 2, CDP-DG synthetase 2, CDP-diacylglycerol synthase 2, CDP-diglyceride pyrophosphorylase 2, CDP-diglyceride synthetase 2, CTP:phosphatidate cytidylyltransferase 2, Phosphatidate cytidylyltransferase 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95674
Immunogen:
The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA.
GeneID:
8760
Application WB
Background Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kises regulating cell growth, calcium metabolism, and protein kise C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for sigling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CDS2 (1 products)

Catalog No. Species Pres. Purity   Source  

CDS2 overexpression lysate

CDS2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn