TA339341 TMEM48 / NDC1 antibody

Rabbit Polyclonal Anti-TMEM48 Antibody

See related secondary antibodies

Search for all "TMEM48 / NDC1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMEM48 / NDC1

Product Description for TMEM48 / NDC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMEM48 / NDC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM48 / NDC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nucleoporin NDC1, Transmembrane protein 48
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTX1
Immunogen:
The immunogen for anti-TMEM48 antibody: synthetic peptide directed towards the middle region of human TMEM48. Synthetic peptide located within the following region: SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD.
GeneID:
55706
Application WB
Background TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM48 / NDC1 (1 products)

Catalog No. Species Pres. Purity   Source  

NDC1 overexpression lysate

NDC1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn