TA339059 KLF6 antibody

Rabbit Polyclonal Anti-KLF6 Antibody

See related secondary antibodies

Search for all "KLF6"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KLF6

Product Description for KLF6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KLF6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B-cell-derived protein 1, BCD1, COPEB, CPBP, Core promoter element-binding protein, GC-rich sites-binding factor GBF, KLF6, Krueppel-like factor 6, Proto-oncogene BCD1, ST12, Transcription factor Zf9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99612
Immunogen:
The immunogen for anti-KLF6 antibody: synthetic peptide directed towards the N terminal of human KLF6. Synthetic peptide located within the following region: REKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS.
GeneID:
1316
Application WB
Background This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptiol activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. [provided by RefSeq, May 2009].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KLF6 (3 products)

Catalog No. Species Pres. Purity   Source  

KLF6 (full length, N-term HIS tag, transcript variant A)

KLF6 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

KLF6 (1-283, His-tag)

KLF6 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / $1,070.00
  OriGene Technologies GmbH

KLF6 (1-283, His-tag)

KLF6 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / $400.00
  OriGene Technologies GmbH

Positive controls for KLF6 (1 products)

Catalog No. Species Pres. Purity   Source  

KLF6 overexpression lysate

KLF6 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn