TA338807 MTPN antibody

Rabbit Polyclonal Anti-MTPN Antibody

See related secondary antibodies

Search for all "MTPN"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MTPN

Product Description for MTPN

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MTPN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MTPN

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GCDP, V-1, myotrophin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P58546
Immunogen:
The immunogen for anti-MTPN antibody: synthetic peptide directed towards the middle region of human MTPN. Synthetic peptide located within the following region: GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV.
GeneID:
136319
Application WB
Background MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel interl ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MTPN (3 products)

Catalog No. Species Pres. Purity   Source  

MTPN

MTPN Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

MTPN (1-118, His-tag)

MTPN Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

MTPN (1-118, His-tag)

MTPN Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn