TA338786 ASIC4 / ACCN4 antibody

Rabbit Polyclonal Anti-ACCN4 Antibody

See related secondary antibodies

Search for all "ASIC4 / ACCN4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASIC4 / ACCN4

Product Description for ASIC4 / ACCN4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASIC4 / ACCN4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASIC4 / ACCN4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acid-sensing ion channel 4, Amiloride-sensitive cation channel 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96FT7
Immunogen:
The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA.
GeneID:
55515
Application WB
Background This gene belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in syptic transmission, pain perception as well as mechanoperception. This gene is predomintly expressed in the pituitary gland, and was considered a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder, however, no correlation was found between mutations in this gene and PDC. [provided by RefSeq, Feb 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ASIC4 / ACCN4 (1 products)

Catalog No. Species Pres. Purity   Source  

ASIC4 / ACCN4 (transcript variant 2)

ASIC4 / ACCN4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for ASIC4 / ACCN4 (1 products)

Catalog No. Species Pres. Purity   Source  

ASIC4 overexpression lysate

ASIC4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn