TA338738 KCTD7 antibody

Rabbit Polyclonal Anti-KCTD7 Antibody

See related secondary antibodies

Search for all "KCTD7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KCTD7

TA338738

More Views

  • TA338738
  • TA338738
  • TA338738

Product Description for KCTD7

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KCTD7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCTD7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein KCTD7
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MP8
Immunogen:
The immunogen for anti-KCTD7 antibody: synthetic peptide directed towards the N terminal of human KCTD7. Synthetic peptide located within the following region: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE.
GeneID:
154881
Application WB
Background This gene encodes a member of the potassium channel tetramerization domain-containing protein family. Family members are identified on a structural basis and contain an amino-termil domain similar to the T1 domain present in the voltage-gated potassium channel. Mutations in this gene have been associated with progressive myoclonic epilepsy-3. Altertive splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCTD7 (2 products)

Catalog No. Species Pres. Purity   Source  

KCTD7 (transcript variant 2)

KCTD7 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

KCTD7 (full length, N-term HIS tag, transcript variant 1)

KCTD7 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for KCTD7 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD7 overexpression lysate

KCTD7 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn