TA338662 SRD5A3 antibody

Rabbit Polyclonal Anti-SRD5A3 Antibody

See related secondary antibodies

Search for all "SRD5A3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast SRD5A3

Product Description for SRD5A3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast SRD5A3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SRD5A3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-oxo-5-alpha-steroid 4-dehydrogenase 3, S5AR3, SRD5A2L, Steroid 5-alpha-reductase 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H8P0
Immunogen:
The immunogen for anti-SRD5A3 antibody: synthetic peptide directed towards the N terminal of human SRD5A3. Synthetic peptide located within the following region: GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN.
GeneID:
79644
Application WB
Background SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SRD5A3 (1 products)

Catalog No. Species Pres. Purity   Source  

SRD5A3 overexpression lysate

SRD5A3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn