TA338628 REEP1 antibody

Rabbit Polyclonal Anti-REEP1 Antibody

See related secondary antibodies

Search for all "REEP1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat REEP1

TA338628

More Views

  • TA338628

Product Description for REEP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat REEP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for REEP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C2orf23, Receptor expression-enhancing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H902
Immunogen:
The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the C terminal of human REEP1. Synthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA.
GeneID:
65055
Application WB
Background REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for REEP1 (1 products)

Catalog No. Species Pres. Purity   Source  

REEP1

REEP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for REEP1 (2 products)

Catalog No. Species Pres. Purity   Source  

REEP1 overexpression lysate

REEP1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

REEP1 overexpression lysate

REEP1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn