TA338609 TMEM168 antibody

Rabbit Polyclonal Anti-TMEM168 Antibody

See related secondary antibodies

Search for all "TMEM168"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TMEM168

Product Description for TMEM168

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TMEM168.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM168

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane protein 168
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0V1
Immunogen:
The immunogen for anti-TMEM168 antibody: synthetic peptide directed towards the C terminal of human TMEM168. Synthetic peptide located within the following region: EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL.
GeneID:
64418
Application WB
Background TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn