TA338581 Melastatin-4 antibody

Rabbit Polyclonal Anti-TRPM4 Antibody

See related secondary antibodies

Search for all "Melastatin-4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Melastatin-4

TA338581

More Views

  • TA338581
  • TA338581
  • TA338581
  • TA338581
  • TA338581
  • TA338581

Product Description for Melastatin-4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Melastatin-4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Melastatin-4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Calcium-activated non-selective cation channel 1, LTRPC4, Long transient receptor potential channel 4, Melastatin-4, TRPM4, Transient receptor potential cation channel subfamily M member 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TD43
Immunogen:
The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI.
GeneID:
54795
Application WB
Background The protein encoded by this gene is a calcium-activated nonselective ion channel that mediates transport of monovalent cations across membranes, thereby depolarizing the membrane. The activity of the encoded protein increases with increasing intracellular calcium concentration, but this channel does not transport calcium. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2010].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Melastatin-4 (1 products)

Catalog No. Species Pres. Purity   Source  

Melastatin-4

Melastatin-4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

Positive controls for Melastatin-4 (1 products)

Catalog No. Species Pres. Purity   Source  

TRPM4 overexpression lysate

TRPM4 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn