TA338559 Serotonin receptor 3B (HTR3B) antibody

Rabbit Polyclonal Anti-HTR3B Antibody

See related secondary antibodies

Search for all "Serotonin receptor 3B (HTR3B)"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Serotonin receptor 3B (HTR3B)

TA338559

More Views

  • TA338559
  • TA338559

Product Description for Serotonin receptor 3B (HTR3B)

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Serotonin receptor 3B (HTR3B).
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for Serotonin receptor 3B (HTR3B)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 5-HT3-B, 5-HT3B, 5-hydroxytryptamine receptor 3B
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95264
Immunogen:
The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT.
GeneID:
9177
Application WB
IHC
IF
Background The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functiol as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functiol features of this receptor. [provided by RefSeq, Aug 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn