TA338555 KCNA10 antibody

Rabbit Polyclonal Anti-KCNA10 Antibody

See related secondary antibodies

Search for all "KCNA10"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat KCNA10

TA338555

More Views

  • TA338555

Product Description for KCNA10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat KCNA10.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KCNA10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Potassium voltage-gated channel subfamily A member 10, Voltage-gated potassium channel subunit Kv1.8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16322
Immunogen:
The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI.
GeneID:
3744
Application WB
IHC
Background Potassium channels represent the most complex class of voltage-gated ion channels from both functiol and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neurol excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KC2 and KC3 on chromosome 1. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KCNA10 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNA10 overexpression lysate

KCNA10 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn