TA338533 P2RX7 / P2X7 antibody

Rabbit Polyclonal Anti-P2RX7 Antibody

See related secondary antibodies

Search for all "P2RX7 / P2X7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat P2RX7 / P2X7

TA338533

More Views

  • TA338533

Product Description for P2RX7 / P2X7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat P2RX7 / P2X7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for P2RX7 / P2X7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP receptor, P2X purinoceptor 7, P2Z receptor, Purinergic receptor
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99572
Immunogen:
The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP.
GeneID:
5027
Application WB
Background The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple altertively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2010].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for P2RX7 / P2X7 (1 products)

Catalog No. Species Pres. Purity   Source  

P2RX7 overexpression lysate

P2RX7 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn