TA338490 Xylosyltransferase 2 / XYLT2 antibody

Rabbit Polyclonal Anti-XYLT2 Antibody

See related secondary antibodies

Search for all "Xylosyltransferase 2 / XYLT2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Xylosyltransferase 2 / XYLT2

Product Description for Xylosyltransferase 2 / XYLT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Xylosyltransferase 2 / XYLT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Xylosyltransferase 2 / XYLT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Peptide O-xylosyltransferase 1, XT-II, XT2, XylT-II, Xylosyltransferase II
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1B5
Immunogen:
The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the middle region of human XYLT2. Synthetic peptide located within the following region: PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW.
GeneID:
64132
Application WB
Background XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteo
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn