TA338474 ADAM30 antibody

Rabbit Polyclonal Anti-ADAM30 Antibody

See related secondary antibodies

Search for all "ADAM30"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human ADAM30

Product Description for ADAM30

Rabbit anti Bovine, Canine, Human ADAM30.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ADAM30

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Disintegrin and metalloproteinase domain-containing protein 30
Presentation Purified
Reactivity Bov, Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKF2
Immunogen:
The immunogen for anti-ADAM30 antibody: synthetic peptide directed towards the N terminal of human ADAM30. Synthetic peptide located within the following region: RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM.
GeneID:
11085
Application WB
Background ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to ske venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-termil repeats.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to ske venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-termil repeats.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn