TA338464 CADM3 antibody

Rabbit Polyclonal Anti-CADM3 Antibody

See related secondary antibodies

Search for all "CADM3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CADM3

Product Description for CADM3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CADM3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CADM3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain immunoglobulin receptor, Cell adhesion molecule 3, IGSF4B, Immunoglobulin superfamily member 4B, NECL1, Nectin-like protein 1, SYNCAM3, Synaptic cell adhesion molecule 3, TSLC1-like protein 1, TSLL1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N126
Immunogen:
The immunogen for anti-CADM3 antibody: synthetic peptide directed towards the middle region of human CADM3. Synthetic peptide located within the following region: KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV.
GeneID:
57863
Application WB
Background IGSF4B is a brain-specific protein related to the calcium-independent cell-cell adhesion molecules known as nectins (see PVRL3; MIM 607147) (Kakuga et al., 2005 [PubMed 15741237]).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CADM3 (2 products)

Catalog No. Species Pres. Purity   Source  

CADM3 (transcript variant 1)

CADM3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

CADM3 (transcript variant 2)

CADM3 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / $299.00
  OriGene Technologies, Inc.

Positive controls for CADM3 (1 products)

Catalog No. Species Pres. Purity   Source  

CADM3 overexpression lysate

CADM3 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn