TA338418 TMEM63C antibody

Rabbit Polyclonal Anti-TMEM63C Antibody

See related secondary antibodies

Search for all "TMEM63C"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TMEM63C

Product Description for TMEM63C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TMEM63C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM63C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C14orf171, CSC1, Calcium permeable stress-gated cation channel 1, Transmembrane protein 63C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P1W3
Immunogen:
The immunogen for anti-TMEM63C antibody: synthetic peptide directed towards the middle region of human TMEM63C. Synthetic peptide located within the following region: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM.
GeneID:
57156
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn