TA338388 CLCNKB antibody

Rabbit Polyclonal Anti-CLCNKB Antibody

See related secondary antibodies

Search for all "CLCNKB"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CLCNKB

Product Description for CLCNKB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CLCNKB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CLCNKB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Chloride channel Kb, Chloride channel protein ClC-Kb, ClC-K2, ClCK2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51801
Immunogen:
The immunogen for anti-CLCNKB antibody: synthetic peptide directed towards the N terminal of human CLCNKB. Synthetic peptide located within the following region: MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW.
GeneID:
1188
Application WB
Background The protein encoded by this gene is a member of the family of voltage-gated chloride channels. Chloride channels have several functions, including the regulation of cell volume, membrane potential stabilization, sigl transduction and transepithelial transport. This gene is expressed predomintly in the kidney and may be important for rel salt reabsorption. Mutations in this gene are associated with autosomal recessive Bartter syndrome type 3 (BS3). Altertively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn