TA338385 KCNA1 antibody

Rabbit Polyclonal Anti-KCNA1 Antibody

See related secondary antibodies

Search for all "KCNA1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat KCNA1

Product Description for KCNA1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat KCNA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HBK1, HUKI, Potassium voltage-gated channel subfamily A member 1, Voltage-gated potassium channel subunit Kv1.1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q09470
Immunogen:
The immunogen for anti-KCNA1 antibody: synthetic peptide directed towards the middle region of human KCNA1. Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC.
GeneID:
3736
Application WB
Background This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functiol channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the ictivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KCNA1 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNA1 overexpression lysate

KCNA1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn